PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g044991m
Common NameCISIN_1g044991mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family S1Fa-like
Protein Properties Length: 115aa    MW: 12733.4 Da    PI: 10.551
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g044991mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA133.45.8e-4247114370
               S1FA   3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 
                        v+ + akG+nPGlivllvvgglllvfl+gnyily+yaqk+lPP+kkkPvskkk+k+e+lkqGv++PGe
  orange1.1g044991m  47 VKDAGAKGFNPGLIVLLVVGGLLLVFLIGNYILYMYAQKTLPPKKKKPVSKKKMKKERLKQGVSAPGE 114
                        566789*************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046892.2E-4051114IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MVRLEPRCCR NINMLSVVGT ILFFCNLFSH VYLQNVTCFN DKQGNTVKDA GAKGFNPGLI  60
VLLVVGGLLL VFLIGNYILY MYAQKTLPPK KKKPVSKKKM KKERLKQGVS APGE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.69530.0callus| flower| fruit| vegetative meristem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104121.11e-28DNA-binding protein S1FA1
SwissprotP425536e-17S1FA1_ORYSJ; DNA-binding protein S1FA1
SwissprotQ7XLX67e-17S1FA2_ORYSJ; DNA-binding protein S1FA2
TrEMBLA0A067DZ382e-78A0A067DZ38_CITSI; Uncharacterized protein
STRINGPGSC0003DMT4000044414e-21(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769